PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02548.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 197aa    MW: 22959.8 Da    PI: 9.1044
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02548.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.1e-191865148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
  Rsa1.0_02548.1_g00003.1 18 KGLWTVEEDKILMDYVKSHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 65
                             678*******************************************97 PP

2Myb_DNA-binding61.61.6e-1971116148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Rsa1.0_02548.1_g00003.1  71 RGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 116
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.231365IPR017930Myb domain
SuperFamilySSF466891.2E-3116112IPR009057Homeodomain-like
SMARTSM007173.3E-151767IPR001005SANT/Myb domain
PfamPF002494.1E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-251972IPR009057Homeodomain-like
CDDcd001679.36E-122165No hitNo description
PROSITE profilePS5129428.73766120IPR017930Myb domain
SMARTSM007175.6E-1970118IPR001005SANT/Myb domain
PfamPF002491.7E-1871116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2873120IPR009057Homeodomain-like
CDDcd001672.89E-1373116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MRKKVSSTGE EGNNEYKKGL WTVEEDKILM DYVKSHGKGH WNRIAKKTGL KRCGKSCRLR  60
WMNYLSPNVK RGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN YWNTHLSKKL  120
GNKDPKTKPS NGDIVHQISH TNPETLEETN ISNINDNSEI QEDRQGSNYL SSHWMHDDEF  180
ELSSLTNMMD FIDGHCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121201108B-MYB
1h8a_C2e-291312022128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3171410.0HQ317141.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 66 (MYB66) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620503.11e-141PREDICTED: transcription factor WER-like
SwissprotQ9SEI01e-127WER_ARATH; Transcription factor WER
TrEMBLA0A0D3AJ341e-141A0A0D3AJ34_BRAOL; Uncharacterized protein
STRINGBra008740.1-P1e-128(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-128myb domain protein 66